PDB entry 2fo4

View 2fo4 on RCSB PDB site
Description: Enhanced MHC class I binding and immune responses through anchor modification of the non-canonical tumor associated MUC1-8 peptide
Class: Immune System
Keywords: anchor modifications, H-2Kb, MUC1, non-canonical peptide, MUC1-8, vaccine design, Immune System
Deposited on 2006-01-12, released 2006-11-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
  Domains in SCOPe 2.01: d2fo4a1, d2fo4a2
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.01: d2fo4b_
• Chain 'P':
  Compound: 8-mer from Mucin-1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16615 (0-7)
    • engineered (4)
    • engineered (7)
• Heterogens: NAG, PO4, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fo4A (A:)
  gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fo4B (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.