PDB entry 2fo4

View 2fo4 on RCSB PDB site
Description: Enhanced MHC class I binding and immune responses through anchor modification of the non-canonical tumor associated MUC1-8 peptide
Class: Immune System
Keywords: anchor modifications, H-2Kb, MUC1, non-canonical peptide, MUC1-8, vaccine design
Deposited on 2006-01-12, released 2006-11-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fo4a1, d2fo4a2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2fo4b1
  • Chain 'P':
    Compound: 8-mer from Mucin-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16615 (0-7)
      • engineered (4)
      • engineered (7)
  • Heterogens: NAG, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fo4A (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fo4B (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.