PDB entry 2fnz

View 2fnz on RCSB PDB site
Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
Class: oxidoreductase
Keywords: Enzyme-inhibitor-cofactor complex, OXIDOREDUCTASE
Deposited on 2006-01-12, released 2007-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.06: d2fnza3, d2fnza4
  • Chain 'B':
    Compound: lactate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Gene: LDH1
    Database cross-references and differences (RAF-indexed):
    • GB AAG17668 (0-End)
      • see remark 999 (183)
    Domains in SCOPe 2.06: d2fnzb3, d2fnzb4
  • Heterogens: SO4, NAD, OXM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fnzA (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnzA (A:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fnzB (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnapaaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnzB (B:)
    mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
    vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
    tnpldvmvshfqkvsglphnkvcgmagvldssrfrtfiaqhfgvnasdvsanvigghgdg
    mvpatssvsvggvplssfikqglitqeqideivchtriawkevadnlktgtayfapaaaa
    vkmaeaylkdkkavvpcsafcsnhygvkgiymgvptiigkngvedileldltpleqkllg
    esinevntiskvldnap