PDB entry 2fns

View 2fns on RCSB PDB site
Description: Crystal structure of wild-type inactive (D25N) HIV-1 protease complexed with wild-type HIV-1 NC-p1 substrate.
Class: hydrolase
Keywords: structural intermediate, substrate recognition, hiv-1 protease, NC-p1 substrate, drug resistance, flap conformation
Deposited on 2006-01-11, released 2006-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (24)
    • engineered (63)
  Domains in SCOP 1.73: d2fnsa1
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (24)
    • engineered (63)
  Domains in SCOP 1.73: d2fnsb1
• Chain 'P':
  Compound: nc-p1 substrate peptide
  Species: synthetic, synthetic
  
• Heterogens: PO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnsA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fnsB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'P':
  No sequence available.