PDB entry 2fns
View 2fns on RCSB PDB site
Description: Crystal structure of wild-type inactive (D25N) HIV-1 protease complexed with wild-type HIV-1 NC-p1 substrate.
Class: hydrolase
Keywords: structural intermediate, substrate recognition, hiv-1 protease, NC-p1 substrate, drug resistance, flap conformation, HYDROLASE
Deposited on
2006-01-11, released
2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot O38716 (0-98)
- engineered (6)
- engineered (24)
- engineered (63)
Domains in SCOPe 2.08: d2fnsa_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: GAG
Database cross-references and differences (RAF-indexed):
- Uniprot O38716 (0-98)
- engineered (6)
- engineered (24)
- engineered (63)
Domains in SCOPe 2.08: d2fnsb_ - Chain 'P':
Compound: nc-p1 substrate peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACT, PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2fnsA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2fnsB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'P':
No sequence available.