PDB entry 2fnn

View 2fnn on RCSB PDB site
Description: Activation of human carbonic anhydrase II by exogenous proton donors
Class: Lyase
Keywords: carbonic anhydrase, proton transfer, exogenous proton donor, Lyase
Deposited on 2006-01-11, released 2006-11-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HCA II, CA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-259)
      • engineered (4)
      • engineered (63)
    Domains in SCOPe 2.03: d2fnna_
  • Heterogens: ZN, 4MZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fnnA (A:)
    mshhagygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
    nngwafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
    vhwntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
    rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
    vdnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fnnA (A:)
    hhagygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    gwafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk