PDB entry 2fn3

View 2fn3 on RCSB PDB site
Description: High resolution structure of s26a mutant of benzoylformate decarboxylase from pseudomonas putida complexed with thiamine thiazolone diphosphate
Class: lyase
Keywords: lyase, carbon-carbon, decarboxylase, mandelate catabolism, thiamine thiazolone diphosphate, high resolution
Deposited on 2006-01-10, released 2006-12-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.128
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906
      • engineered (25)
    Domains in SCOP 1.73: d2fn3a1, d2fn3a2, d2fn3a3
  • Heterogens: MG, CA, TZD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fn3A (A:)
    masvhgttyellrrqgidtvfgnpganelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fn3A (A:)
    asvhgttyellrrqgidtvfgnpganelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvs