PDB entry 2fmy

View 2fmy on RCSB PDB site
Description: CO-dependent transcription factor CooA from Carboxydothermus hydrogenoformans (Imidazole-bound form)
Class: DNA binding protein
Keywords: DNA transcription regulator, DNA BINDING PROTEIN
Deposited on 2006-01-10, released 2007-01-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbon monoxide oxidation system transcription regulator CooA-1
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Database cross-references and differences (RAF-indexed):
    • GB ABB15035
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2fmya1, d2fmya2
  • Chain 'B':
    Compound: carbon monoxide oxidation system transcription regulator CooA-1
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Database cross-references and differences (RAF-indexed):
    • GB ABB15035
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2fmyb1, d2fmyb2
  • Chain 'C':
    Compound: carbon monoxide oxidation system transcription regulator CooA-1
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Database cross-references and differences (RAF-indexed):
    • GB ABB15035
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2fmyc1, d2fmyc2
  • Chain 'D':
    Compound: carbon monoxide oxidation system transcription regulator CooA-1
    Species: Carboxydothermus hydrogenoformans [TaxId:129958]
    Database cross-references and differences (RAF-indexed):
    • GB ABB15035 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.04: d2fmyd1, d2fmyd2
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmyA (A:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmyA (A:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmyB (B:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmyB (B:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fmyC (C:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmyC (C:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fmyD (D:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmyD (D:)
    atqmrltdtnllevlnseeysgvlkefreqryskkailytpnternlvflvksgrvrvyl
    ayedkeftlaileagdifcthtrafiqamedttilytdirnfqnivvefpafslnmvkvl
    gdllknsltiinglvfkdarlrlaeflvqaamdtglkvpqgiklelglnteeialmlgtt
    rqtvsvllndfkkmgilervnqrtlllkdlqklkefss