PDB entry 2fmx

View 2fmx on RCSB PDB site
Description: An open conformation of switch I revealed by Sar1-GDP crystal structure at low Mg(2+)
Class: protein transport
Keywords: Sar1, crystal structure, COP II assembly, dimerization, PROTEIN TRANSPORT
Deposited on 2006-01-10, released 2006-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.224
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein SAR1b
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fmxa_
  • Chain 'B':
    Compound: GTP-binding protein SAR1b
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fmxb_
  • Heterogens: SO4, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fmxA (A:)
    hhhhhhsgfssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptsee
    ltiagmtfttfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdet
    ianvpililgnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkr
    qgygegfrwmaqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmxA (A:)
    ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
    tfdlgrvwknylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidr
    peaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fmxB (B:)
    hhhhhhsgfssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptsee
    ltiagmtfttfdlgghiqarrvwknylpaingivflvdcadherlleskeeldslmtdet
    ianvpililgnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkr
    qgygegfrwmaqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fmxB (B:)
    ssvlqflglykktgklvflgldnagkttllhmlkdptlhptseeltiagmtfttfdlgvw
    knylpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeaiseer
    lremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid