PDB entry 2fmb

View 2fmb on RCSB PDB site
Description: eiav protease complexed with an inhibitor lp-130
Deposited on 1998-07-13, released 1999-01-13
The last revision prior to the SCOP 1.59 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.143
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2fmb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fmb_ (-)
    vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
    etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl