PDB entry 2fm1

View 2fm1 on RCSB PDB site
Description: Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution
Class: lyase
Keywords: tm1744, L-ALLO-threonine aldolase, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, LYASE
Deposited on 2006-01-06, released 2006-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.146
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • GB AAD36809 (12-354)
      • modified residue (210)
    Domains in SCOPe 2.04: d2fm1a_
  • Chain 'B':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • GB AAD36809 (12-354)
      • modified residue (210)
    Domains in SCOPe 2.04: d2fm1b_
  • Chain 'C':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • GB AAD36809 (12-354)
      • modified residue (210)
    Domains in SCOPe 2.04: d2fm1c_
  • Chain 'D':
    Compound: L-allo-threonine aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1744
    Database cross-references and differences (RAF-indexed):
    • GB AAD36809 (12-354)
      • leader sequence (10-11)
      • modified residue (210)
    Domains in SCOPe 2.04: d2fm1d_
  • Heterogens: CA, NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fm1A (A:)
    mgsdkihhhhhhmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfg
    keaalfvpsgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkng
    amdpddvrkairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhid
    garifnasiasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgg
    gmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdn
    lkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm1A (A:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fm1B (B:)
    mgsdkihhhhhhmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfg
    keaalfvpsgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkng
    amdpddvrkairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhid
    garifnasiasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgg
    gmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdn
    lkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm1B (B:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fm1C (C:)
    mgsdkihhhhhhmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfg
    keaalfvpsgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkng
    amdpddvrkairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhid
    garifnasiasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgg
    gmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdn
    lkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm1C (C:)
    midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
    gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
    prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
    vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
    iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
    rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fm1D (D:)
    mgsdkihhhhhhmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfg
    keaalfvpsgtmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkng
    amdpddvrkairprnihfprtsliaienthnrsggrvvplenikeictiakehginvhid
    garifnasiasgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgg
    gmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdn
    lkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm1D (D:)
    hhmidlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsg
    tmgnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrka
    irprnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasia
    sgvpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaa
    agiialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfie
    alrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs