PDB entry 2flh

View 2flh on RCSB PDB site
Description: Crystal structure of cytokinin-specific binding protein from mung bean in complex with cytokinin
Class: plant protein
Keywords: cytokinins, zeatin, pathogenesis-related proteins, multiple-ligand binding, PLANT PROTEIN
Deposited on 2006-01-06, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.16
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata [TaxId:157791]
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • GB BAA74451 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d2flha_
  • Chain 'B':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata [TaxId:157791]
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • GB BAA74451 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d2flhb_
  • Chain 'C':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata [TaxId:157791]
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • GB BAA74451 (0-End)
      • see remark 999 (91)
    Domains in SCOPe 2.06: d2flhc_
  • Chain 'D':
    Compound: cytokinin-specific binding protein
    Species: Vigna radiata [TaxId:157791]
    Gene: vrcsbp
    Database cross-references and differences (RAF-indexed):
    • GB BAA74451
      • see remark 999 (91)
    Domains in SCOPe 2.06: d2flhd_
  • Heterogens: NA, ZEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2flhA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flhA (A:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhvtptktsqstlmylrrleryls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2flhB (B:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flhB (B:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2flhC (C:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flhC (C:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2flhD (D:)
    mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
    evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
    dhdsdieekvtptktsqstlmylrrlerylsngsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2flhD (D:)
    vkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflpe
    vspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisyd
    hdsdieekvtptktsqstlmylrrlerylsngs