PDB entry 2flg

View 2flg on RCSB PDB site
Description: Solution structure of an EGF-LIKE domain from the Plasmodium falciparum merozoite surface protein 1
Class: surface active protein
Keywords: egf-like domain, extracellular, modular protein, surface antigen, malaria vaccine component, surface protein, surface active protein
Deposited on 2006-01-06, released 2006-02-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Merozoite surface protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2flga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2flgA (A:)
    nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnpt