PDB entry 2flg

View 2flg on RCSB PDB site
Description: Solution structure of an EGF-LIKE domain from the Plasmodium falciparum merozoite surface protein 1
Class: surface active protein
Keywords: egf-like domain, extracellular, modular protein, surface antigen, malaria vaccine component, surface protein, surface active protein
Deposited on 2006-01-06, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Merozoite surface protein 1
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04933 (0-47)
  Domains in SCOPe 2.08: d2flga1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2flgA (A:)
  nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenpnpt