PDB entry 2fl5

View 2fl5 on RCSB PDB site
Description: Cofactor-containing antibodies: Crystal structure of the original yellow antibody
Class: immune system
Keywords: human antibody, riboflavin-binding, cofactor, multiple myeloma, IGGGAR, IMMUNE SYSTEM
Deposited on 2006-01-05, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin Igg1 Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fl5a1, d2fl5a2
  • Chain 'B':
    Compound: Immunoglobulin Igg1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Immunoglobulin Igg1 Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fl5c1, d2fl5c2
  • Chain 'D':
    Compound: Immunoglobulin Igg1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Immunoglobulin Igg1 Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fl5e1, d2fl5e2
  • Chain 'F':
    Compound: Immunoglobulin Igg1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Immunoglobulin Igg1 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Immunoglobulin Igg1 Lambda Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fl5l1, d2fl5l2
  • Heterogens: RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl5A (A:)
    syelkqppsvsvspgqtaritcsgdvlpkkyaywyqersgqapvlvvyedsgrpseiper
    fsgsssgtkatltisgaqvedeadyycysdisngyplfgggtklsvgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl5C (C:)
    syelkqppsvsvspgqtaritcsgdvlpkkyaywyqersgqapvlvvyedsgrpseiper
    fsgsssgtkatltisgaqvedeadyycysdisngyplfgggtklsvgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl5E (E:)
    syelkqppsvsvspgqtaritcsgdvlpkkyaywyqersgqapvlvvyedsgrpseiper
    fsgsssgtkatltisgaqvedeadyycysdisngyplfgggtklsvgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl5L (L:)
    syelkqppsvsvspgqtaritcsgdvlpkkyaywyqersgqapvlvvyedsgrpseiper
    fsgsssgtkatltisgaqvedeadyycysdisngyplfgggtklsvgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspikagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvapt