PDB entry 2fl0

View 2fl0 on RCSB PDB site
Description: Oxidized (All ferric) form of the Azotobacter vinelandii bacterioferritin
Class: metal binding protein
Keywords: Bacterioferritin, Ferritin, Diiron site, Iron transport, METAL BINDING PROTEIN
Deposited on 2006-01-05, released 2006-04-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.203
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0a_
  • Chain 'B':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0b_
  • Chain 'C':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0c_
  • Chain 'D':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0d_
  • Chain 'E':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0e_
  • Chain 'F':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0f_
  • Chain 'G':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0g_
  • Chain 'H':
    Compound: bacterioferritin
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2fl0h_
  • Heterogens: FE2, MG, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0A (A:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0B (B:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0C (C:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0D (D:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0E (E:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0F (F:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0G (G:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fl0H (H:)
    mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
    rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
    edileseedhidwletqldlidkiglenylqsqmd