PDB entry 2fk9

View 2fk9 on RCSB PDB site
Description: Human protein kinase C, eta
Class: transferase
Keywords: ATP-binding, Kinase, Metal-binding, Nucleotide-binding, Diacylglycerol binding, Serine/threonine-protein kinase, Transferase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2006-01-04, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase C, eta type
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKCH
    Database cross-references and differences (RAF-indexed):
    • GB NP_006246
      • expression tag (9)
      • cloning artifact (10-15)
    Domains in SCOPe 2.06: d2fk9a1, d2fk9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fk9A (A:)
mgsshhhhhhssglvprgsmssgtmkfngylrvrigeavglqptrwslrhslfkkghqll
dpyltvsvdqvrvgqtstkqktnkptyneefcanvtdgghlelavfhetplgydhfvanc
tlqfqellrttgasdtfegwvdlepegkvfvvitltg

    Sequence, based on observed residues (ATOM records): (download) 
    >2fk9A (A:)
hssglvptmkfngylrvrigeavglqptrwslrhslfkkghqlldpyltvsvdqvrvgqt
stkqktnkptyneefcanvtdgghlelavfhetplgydhfvanctlqfqellrttgasdt
fegwvdlepegkvfvvitlt