PDB entry 2fk8

View 2fk8 on RCSB PDB site
Description: Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis complexed with S-adenosylmethionine
Class: transferase
Keywords: s-adenosylmethionine-dependent methyltransferase fold, transferase
Deposited on 2006-01-04, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methoxy mycolic acid synthase 4
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mmaA4 (Rv0642c)
    Database cross-references and differences (RAF-indexed):
    • GB AAK44896 (Start-317)
    Domains in SCOPe 2.06: d2fk8a_
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fk8A (A:)
    mgsshyhhhhssglvprgshmaekpisptktrtrfediqahydvsddffalfqdptrtys
    cayfeppeltleeaqyakvdlnldkldlkpgmtlldigcgwgttmrraverfdvnviglt
    lsknqharceqvlasidtnrsrqvllqgwedfaepvdrivsieafehfghenyddffkrc
    fnimpadgrmtvqssvsyhpyemaargkklsfetarfikfivteifpggrlpstemmveh
    gekagftvpeplslrphyiktlriwgdtlqsnkdkaievtseevynrymkylrgcehyft
    demldcslvtylkpgaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk8A (A:)
    iqahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldi
    gcgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvd
    rivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarf
    ikfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkai
    evtseevynrymkylrgcehyftdemldcslvtylkpgaaa