PDB entry 2fk7

View 2fk7 on RCSB PDB site
Description: Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis, apo-form
Class: transferase
Keywords: s-adenosylmethionine-dependent methyltransferase fold, transferase
Deposited on 2006-01-04, released 2006-01-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methoxy mycolic acid synthase 4
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mmaA4 (Rv0642c)
    Database cross-references and differences (RAF-indexed):
    • GB AAK44896 (Start-317)
    Domains in SCOPe 2.06: d2fk7a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fk7A (A:)
    mgsshyhhhhssglvprgshmaekpisptktrtrfediqahydvsddffalfqdptrtys
    cayfeppeltleeaqyakvdlnldkldlkpgmtlldigcgwgttmrraverfdvnviglt
    lsknqharceqvlasidtnrsrqvllqgwedfaepvdrivsieafehfghenyddffkrc
    fnimpadgrmtvqssvsyhpyemaargkklsfetarfikfivteifpggrlpstemmveh
    gekagftvpeplslrphyiktlriwgdtlqsnkdkaievtseevynrymkylrgcehyft
    demldcslvtylkpgaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fk7A (A:)
    qahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldig
    cgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvdr
    ivsieafehenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarfikfi
    vteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkaievts
    eevynrymkylrgcehyftdemldcslvtylkpgaaa