PDB entry 2fjm

View 2fjm on RCSB PDB site
Description: The structure of phosphotyrosine phosphatase 1B in complex with compound 2
Class: hydrolase
Keywords: phosphatase, secondary binding site, selectivity, hydrolase
Deposited on 2006-01-03, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-End)
      • cloning artifact (8-11)
    Domains in SCOPe 2.07: d2fjma1, d2fjma2
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-End)
      • cloning artifact (8-11)
    Domains in SCOPe 2.07: d2fjmb1, d2fjmb2
  • Heterogens: CL, 073, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fjmA (A:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgsvkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvq
    dqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjmA (A:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fjmB (B:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgsvkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvq
    dqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjmB (B:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds