PDB entry 2fjd

View 2fjd on RCSB PDB site
Description: adenosine-5-phosphosulfate reductase in complex with sulfite (covalent adduct)
Class: oxidoreductase
Keywords: APS reductase, sulfur cycle, oxidoreductase
Deposited on 2006-01-02, released 2006-03-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.157
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fjdb_
  • Chain 'C':
    Compound: adenylylsulfate reductase, subunit A
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: adenylylsulfate reductase, subunit B
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2fjdd_
  • Heterogens: SFD, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fjdB (B:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjdB (B:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fjdD (D:)
    mpsfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqg
    aidvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpe
    pteealksellagepeiigtsefpqvkkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fjdD (D:)
    psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
    idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
    teealksellagepeiigtsefpqvkkka