PDB entry 2fi5
View 2fi5 on RCSB PDB site
Description: Crystal structure of a BPTI variant (Cys38->Ser) in complex with trypsin
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEASE-INHIBITOR COMPLEX, hydrolase-hydrolase inhibitor COMPLEX
Deposited on
2005-12-27, released
2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-08-29, with a file datestamp of
2018-08-24.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: cationic trypsin
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00760 (0-215)
- engineered mutation (96)
- microheterogeneity (96)
Domains in SCOPe 2.08: d2fi5e_ - Chain 'I':
Compound: pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2fi5i_ - Heterogens: NA, CA, SO4, EDO, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>2fi5E (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaasldsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>2fi5I (I:)
rpdfcleppytgpckariiryfynakaglcqtfvyggsrakrnnfksaedcmrtcgga