PDB entry 2fho

View 2fho on RCSB PDB site
Description: NMR solution structure of the human spliceosomal protein complex p14-SF3b155
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-12-26, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spliceosomal protein SF3b155
    Species: Homo sapiens [TaxId:9606]
    Gene: SF3b155
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75533 (1-46)
      • cloning artifact (0)
  • Chain 'B':
    Compound: spliceosomal protein p14
    Species: Homo sapiens [TaxId:9606]
    Gene: p14
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3B4 (1-86)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2fhob1, d2fhob2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fhoB (B:)
    granirlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyed
    ifdaknacdhlsgfnvcnrylvvlyyn