PDB entry 2fhh

View 2fhh on RCSB PDB site
Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome in complex with a peptidyl boronate inhibitor MLN-273
Class: hydrolase
Keywords: multi-subunit protein assembly, inhibitor-complex, HYDROLASE
Deposited on 2005-12-23, released 2006-02-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.228
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhh1_
  • Chain '2':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhh2_
  • Chain 'A':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhha_
  • Chain 'B':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhb_
  • Chain 'C':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhc_
  • Chain 'D':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhd_
  • Chain 'E':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhe_
  • Chain 'F':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhf_
  • Chain 'G':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhg_
  • Chain 'H':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhh_
  • Chain 'I':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhi_
  • Chain 'J':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhj_
  • Chain 'K':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhk_
  • Chain 'L':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhl_
  • Chain 'M':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhm_
  • Chain 'N':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhn_
  • Chain 'O':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhho_
  • Chain 'P':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhp_
  • Chain 'Q':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhq_
  • Chain 'R':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhr_
  • Chain 'S':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhs_
  • Chain 'T':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhht_
  • Chain 'U':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhu_
  • Chain 'V':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhv_
  • Chain 'W':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhw_
  • Chain 'X':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhx_
  • Chain 'Y':
    Compound: 20S proteasome, alpha and beta subunits
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcA
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00771179
    Domains in SCOPe 2.01: d2fhhy_
  • Chain 'Z':
    Compound: proteasome, beta subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PrcB
    Database cross-references and differences (RAF-indexed):
    • GB AAK46453 (0-End)
    Domains in SCOPe 2.01: d2fhhz_
  • Heterogens: M1N, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2fhh1 (1:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhh1 (1:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2fhh2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhh2 (2:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhhA (A:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhA (A:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fhhB (B:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhB (B:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fhhC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhC (C:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fhhD (D:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhD (D:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2fhhE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhE (E:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2fhhF (F:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhF (F:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2fhhG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhG (G:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fhhH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhH (H:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2fhhI (I:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhI (I:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2fhhJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhJ (J:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2fhhK (K:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhK (K:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2fhhL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhL (L:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2fhhM (M:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhM (M:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2fhhN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhN (N:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2fhhO (O:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhO (O:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2fhhP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhP (P:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2fhhQ (Q:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhQ (Q:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2fhhR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhR (R:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2fhhS (S:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhS (S:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2fhhT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhT (T:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2fhhU (U:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhU (U:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2fhhV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhV (V:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2fhhW (W:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhW (W:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2fhhX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhX (X:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2fhhY (Y:)
    mnsssfpyfispeqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkisely
    drvgfaaagkfnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakp
    yevelcvaevahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasl
    tdalriavaalragsadtsggdqptlgvaslevavldanrprrafrritgsalqallvdq
    espqsdgessg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhY (Y:)
    speqamrerselarkgiaraksvvalayaggvlfvaenpsrslqkiselydrvgfaaagk
    fnefdnlrrggiqfadtrgyaydrrdvtgrqlanvyaqtlgtifteqakpyevelcvaev
    ahygetkrpelyritydgsiadephfvvmggttepianalkesyaenasltdalriavaa
    lragslgvaslevavldanrprrafrritgsalqallvdq
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2fhhZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsgadtfgsdggekhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhhZ (Z:)
    ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
    velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
    vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
    tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs