PDB entry 2fhe

View 2fhe on RCSB PDB site
Description: fasciola hepatica glutathione s-transferase isoform 1 in complex with glutathione
Deposited on 1998-10-21, released 1998-10-28
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fheA (A:)
    paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
    kckltqslailryiadkhgmigttseerarvsmiegaavdlrqgisrisyqpkfeqlkeg
    ylkdlpttmkmwsdflgknpylrgtsvshvdfmvyealdairylephcldhfpnlqqfms
    riealpsikaymesnrfikwplngwhaqfgggdapp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fheB (B:)
    paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd
    kckltqslailryiadkhgmigttseerarvsmiegaavdlrqgisrisyqpkfeqlkeg
    ylkdlpttmkmwsdflgknpylrgtsvshvdfmvyealdairylephcldhfpnlqqfms
    riealpsikaymesnrfikwplngwhaqfgggdapp