PDB entry 2fha

View 2fha on RCSB PDB site
Description: human h chain ferritin
Class: iron storage
Keywords: iron storage
Deposited on 1997-03-03, released 1997-09-04
The last revision prior to the SCOP 1.73 freeze date was dated 1997-09-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered (86)
    Domains in SCOP 1.73: d2fhaa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhaA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd
    nes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhaA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg