PDB entry 2fh8

View 2fh8 on RCSB PDB site
Description: Crystal Structure Analysis of Klebsiella pneumoniae pullulanase complexed with isomaltose
Class: hydrolase
Keywords: multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with isomaltose, HYDROLASE
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed):
    • GB AAA25124 (Start-1082)
      • engineered (679)
      • engineered (881)
    Domains in SCOPe 2.05: d2fh8a1, d2fh8a2, d2fh8a3, d2fh8a4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fh8A (A:)
    cdnssssstsgspgspgnpgnpgtpgtpdpqdvvvrlpdvavpgeavqasarqavihlvd
    iagitsstpadyatknlylwnnetcdalsapvadwndvsttptgsdkygpywvipltkes
    gcinvivrdgtnklidsdlrvsfsdftdrtvsviagnsavydsradafraafgvaladah
    wvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltpttvnqqvsmrfphla
    sypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvlddtyaaaaealsygaq
    ltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswqggsdlkgafyrya
    mtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalkpegwdgltmphaqktkad
    lakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqhlkqlsasgvthiellpvf
    dlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgstveevltqlkqndskdnp
    qvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarikefrtmiqaikqdlgmnvi
    mdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesatccsdsapehrmfakliad
    slavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiyffgegwdsnqsdrfeias
    qinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsgagvlpnelttlsddqarhl
    adltrlgmagnladfvlidkdgavkrgseidyngapggyaadptevvnyvskhdnqtlwd
    misykaaqeadldtrvrmqavslatvmlgqgiafdqqgsellrsksftrdsydsgdwfnr
    vdyslqdnnynvgmprssddgsnydiiarvkdavatpgetelkqmtafyqeltalrkssp
    lftlgdgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesr
    tlqdfagtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpv
    ssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh8A (A:)
    dvvvrlpdaafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefsdkyv
    kltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatqvqta
    gvlddtyaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsas
    gawswqggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsal
    kpegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvq
    hlkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsg
    stveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpegtari
    kefrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesa
    tccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikalnpdi
    yffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsg
    agvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapggyaa
    dptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqqgsel
    lrsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatpgete
    lkqmtafyqeltalrkssplftlgdgatvmkrvdfrntgadqqtgllvmtiddgmqagas
    ldsrvdgivvainaapesrtlqdfagtslqlsaiqqaagdrslasgvqvaadgsvtlpaw
    svavlelpqgesqgaglpvssk