PDB entry 2fgz

View 2fgz on RCSB PDB site
Description: Crystal Structure Analysis of apo pullulanase from Klebsiella pneumoniae
Class: hydrolase
Keywords: multiple domain, beta-alpha-barrel, alpha-amylase-family, HYDROLASE
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed):
    • GB AAA25124 (Start-1082)
      • engineered (679)
      • engineered (881)
    Domains in SCOPe 2.06: d2fgza1, d2fgza2, d2fgza3, d2fgza4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fgzA (A:)
    cdnssssstsgspgspgnpgnpgtpgtpdpqdvvvrlpdvavpgeavqasarqavihlvd
    iagitsstpadyatknlylwnnetcdalsapvadwndvsttptgsdkygpywvipltkes
    gcinvivrdgtnklidsdlrvsfsdftdrtvsviagnsavydsradafraafgvaladah
    wvdkttllwpggenkpivrlyyshsskvaadsngefsdkyvkltpttvnqqvsmrfphla
    sypafklpddvnvdellqgetvaiaaesdgilssatqvqtagvlddtyaaaaealsygaq
    ltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswqggsdlkgafyrya
    mtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalkpegwdgltmphaqktkad
    lakmtiheshirdlsawdqtvpaelrgkylaltaqesnmvqhlkqlsasgvthiellpvf
    dlatvnefsdkvadiqqpfsrlcevnsavkssefagycdsgstveevltqlkqndskdnp
    qvqalntlvaqtdsynwgydpfhytvpegsyatdpegtarikefrtmiqaikqdlgmnvi
    mdvvynhtnaagptdrtsvldkivpwyyqrlnettgsvesatccsdsapehrmfakliad
    slavwttdykidgfrfdlmlyhpkaqilsawerikalnpdiyffgegwdsnqsdrfeias
    qinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqgvgsgagvlpnelttlsddqarhl
    adltrlgmagnladfvlidkdgavkrgseidyngapggyaadptevvnyvskhdnqtlwd
    misykaaqeadldtrvrmqavslatvmlgqgiafdqqgsellrsksftrdsydsgdwfnr
    vdyslqdnnynvgmprssddgsnydiiarvkdavatpgetelkqmtafyqeltalrkssp
    lftlgdgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesr
    tlqdfagtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpv
    ssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgzA (A:)
    dvvvrlpddafraafgvaladahwvdkttllwpggenkpivrlyyshsskvaadsngefs
    dkyvkltpttvnqqvsmrfphlasypafklpddvnvdellqgetvaiaaesdgilssatq
    vqtagvlddtyaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtr
    dsasgawswqggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdln
    dsalkpegwdgltmphaqktkadlakmtiheshirdlsawdqtvpaelrgkylaltaqes
    nmvqhlkqlsasgvthiellpvfdlatvnefsdkvadiqqpfsrlcevnsavkssefagy
    cdsgstveevltqlkqndskdnpqvqalntlvaqtdsynwgydpfhytvpegsyatdpeg
    tarikefrtmiqaikqdlgmnvimdvvynhtnaagptdrtsvldkivpwyyqrlnettgs
    vesatccsdsapehrmfakliadslavwttdykidgfrfdlmlyhpkaqilsawerikal
    npdiyffgegwdsnqsdrfeiasqinlkgtgigtfsdrlrdavrgggpfdsgdalrqnqg
    vgsgagvlpnelttlsddqarhladltrlgmagnladfvlidkdgavkrgseidyngapg
    gyaadptevvnyvskhdnqtlwdmisykaaqeadldtrvrmqavslatvmlgqgiafdqq
    gsellrsksftrdsydsgdwfnrvdyslqdnnynvgmprssddgsnydiiarvkdavatp
    getelkqmtafyqeltalrkssplftlgdgatvmkrvdfrntgadqqtgllvmtiddgmq
    agasldsrvdgivvainaapesrtlqdfagtslqlsaiqqaagdrslasgvqvaadgsvt
    lpawsvavlelpqgesqgaglpvssk