PDB entry 2fgw

View 2fgw on RCSB PDB site
Description:
Deposited on 1994-01-16, released 1994-04-30
The last revision prior to the SCOP 1.65 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 3 Å
R-factor: 0.176
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2fgwh1, d2fgwh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2fgwl1, d2fgwl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2fgwH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
    nqrfmdrftisvdkststaymqmnslraedtavyycarwrglnygfdvryfdvwgqgtlv
    tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav
    lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fgwH (H:)
    evqlvesggglvqpggslrlscatsgytfteytmhwmrqapgkglewvaginpknggtsh
    nqrfmdrftisvdkststaymqmnslraedtavyycarwrryfdvwgqgtlvtvssastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fgwL (L:)
    diqmtqspsslsasvgdrvtitcrasqdinnylnwyqqkpgkapklliyytstlhsgvps
    rfsgsgsgtdytltisslqpedfatyycqqgntlpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec