PDB entry 2fgv

View 2fgv on RCSB PDB site
Description: X-ray crystal structure of HIV-1 Protease T80N variant in complex with the inhibitor saquinavir used to explore the role of invariant Thr80 in HIV-1 protease structure, function, and viral infectivity.
Class: hydrolase
Keywords: HIV Protease, drug resistance, enzyme kinetics, sequence conservation, protein structure, hydrolase
Deposited on 2005-12-22, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38716 (0-98)
      • engineered (6)
      • engineered (63)
      • engineered (79)
    Domains in SCOPe 2.07: d2fgva_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O38716 (0-98)
      • engineered (6)
      • engineered (63)
      • engineered (79)
    Domains in SCOPe 2.07: d2fgvb_
  • Heterogens: PO4, QNC, ASN, HPH, DIQ, NTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fgvA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgpnpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fgvB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgpnpvniigrnlltqigctlnf