PDB entry 2fgr

View 2fgr on RCSB PDB site
Description: High resolution Xray structure of Omp32
Class: membrane protein
Keywords: Omp32 Porin Outer membrane protein
Deposited on 2005-12-22, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.151
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: outer membrane porin protein 32
    Species: Delftia acidovorans [TaxId:80866]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24305 (0-331)
      • see remark 999 (0)
    Domains in SCOPe 2.08: d2fgra_
  • Chain 'B':
    Compound: pap
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2FGR (0-7)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fgrA (A:)
    essvtlfgivdtnvayvnkdaagdsryglgtsgastsrlglrgtedlggglkagfwlege
    ifgddgnasgfnfkrrstvslsgnfgevrlgrdlvptsqkltsydlfsatgigpfmgfrn
    waagqgaddngirannlisyytpnfggfnagfgyafdekqtigtadsvgryiggyvaydn
    gplsaslglaqqktavgglatdrdeitlgasynfgvaklsgllqqtkfkrdiggdiktns
    ymlgasapvggvgevklqyalydqkaidskahqitlgyvhnlskrtalygnlaflknkda
    stlglqakgvyaggvqagesqtgvqvgirhaf
    

  • Chain 'B':
    No sequence available.