PDB entry 2ffq

View 2ffq on RCSB PDB site
Description: The crystal structure of human neuronal Rab6B in its active GTPgS-bound form
Class: hydrolase
Keywords: protein-nucleotide complex, HYDROLASE
Deposited on 2005-12-20, released 2006-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-6B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB6B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NRW1 (1-162)
      • cloning artifact (163-164)
    Domains in SCOPe 2.03: d2ffqa_
  • Heterogens: MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ffqA (A:)
    gkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtag
    qerfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdla
    dkrqitieegeqrakelsvmfietsaktgynvkqlfrrvasallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ffqA (A:)
    kfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdtagq
    erfrslipsyirdstvavvvyditnlnsfqqtskwiddvrtergsdviimlvgnktdlad
    krqitieegeqrakelsvmfietsaktgynvkqlfrrvasalle