PDB entry 2fff

View 2fff on RCSB PDB site
Description: Open Form of a Class A Transpeptidase Domain
Class: membrane protein, transferase
Keywords: transpeptidase fold, MEMBRANE PROTEIN, TRANSFERASE
Deposited on 2005-12-19, released 2006-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penicillin-binding protein 1b
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: penicillin-binding protein 1b
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2fffb1
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fffB (B:)
    dylyfttlaeaqermydylaqrdnvsakelkneatqkfyrdlaakeienggykitttidq
    kihsamqsavadygyllddgtgrvevgnvlmdnqtgailgfvggrnyqenqnnhafdtkr
    spasttkpllaygiaidqglmgsetilsnyptnfangnpimyanskgtgmmtlgealnys
    wnipaywtyrmlrengvdvkgymekmgyeipeygieslpmgggievtvaqhtngyqtlan
    ngvyhqkhviskieaadgrvvyeyqdkpvqvyskatatimqgllrevlssrvtttfksnl
    tslnptlanadwigktgttnqdenmwlmlstprltlggwighddnhslsrragysnnsny
    mahlvnaiqqaspsiwgnerfaldpsvvksevlkstgqkpgkvsvegkevevtgstvtsy
    wanksgapatsyrfaiggsdadyqnawssivgs