PDB entry 2ffd

View 2ffd on RCSB PDB site
Description: Fibrinogen Fragment D with "A" knob peptide mimic GPRVVE
Class: blood clotting
Keywords: Complex of fibrinogen with "A" site mimic GPRVVE in both "A" and "B" sites, BLOOD CLOTTING
Deposited on 2005-12-19, released 2006-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fibrinogen alpha/alpha-E Chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02671 (0-End)
  Domains in SCOPe 2.08: d2ffda1
• Chain 'B':
  Compound: fibrinogen beta chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02675
• Chain 'C':
  Compound: Fibrinogen gamma chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02679 (0-End)
• Chain 'D':
  Compound: Fibrinogen alpha/alpha-E Chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02671
  Domains in SCOPe 2.08: d2ffdd1
• Chain 'E':
  Compound: fibrinogen beta chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02675
• Chain 'F':
  Compound: Fibrinogen gamma chain
  Species: Homo sapiens [TaxId:9606]
  Gene: FGG
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02679
• Chain 'G':
  Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2FFD (0-End)
• Chain 'H':
  Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2FFD (0-End)
• Chain 'I':
  Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2FFD (0-End)
• Chain 'J':
  Compound: GLY-PRO-ARG-VAL-VAL-GLU peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2FFD (0-End)
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ffdA (A:)
  viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
  eqviak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ffdA (A:)
  viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
  eqvia
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2ffdD (D:)
  viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
  eqviak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ffdD (D:)
  iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvi
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.