PDB entry 2fe3

View 2fe3 on RCSB PDB site
Description: The crystal structure of bacillus subtilis PerR-Zn reveals a novel Zn(Cys)4 Structural redox switch
Class: DNA binding protein
Keywords: Oxidative stress regulator, DNA binding protein
Deposited on 2005-12-15, released 2006-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fe3a_
  • Chain 'B':
    Compound: Peroxide operon regulator
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2fe3b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fe3A (A:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fe3A (A:)
    helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
    rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
    kvshhrleiygvcqecskken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fe3B (B:)
    maahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvy
    nnlrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahv
    tgfkvshhrleiygvcqecskkenh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fe3B (B:)
    ahelkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynn
    lrvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtg
    fkvshhrleiygvcqecskkenh