PDB entry 2fd3

View 2fd3 on RCSB PDB site
Description: Crystal Structure of Thioredoxin Mutant P34H
Class: electron transport
Keywords: Alpha Beta, Electron transport
Deposited on 2005-12-13, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (33)
    Domains in SCOPe 2.07: d2fd3a_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, fipA, tsnC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (33)
    Domains in SCOPe 2.07: d2fd3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd3A (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcghckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fd3B (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcghckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla