PDB entry 2fcl

View 2fcl on RCSB PDB site
Description: Crystal structure of a putative nucleotidyltransferase (tm1012) from Thermotoga maritima at 1.35 A resolution
Class: structural genomics, unknown function
Keywords: tm1012, hypothetical protein, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG
Deposited on 2005-12-12, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.142
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1012
    Species: Thermotoga maritima
    Gene: tm1012
    Database cross-references and differences (RAF-indexed):
    • GB AAD36089 (12-168)
      • see remark 999 (23)
      • see remark 999 (29)
      • see remark 999 (32)
      • see remark 999 (77-78)
      • see remark 999 (86)
      • see remark 999 (100)
      • see remark 999 (109)
      • see remark 999 (124)
      • see remark 999 (126)
      • see remark 999 (135)
      • see remark 999 (150)
      • see remark 999 (156)
      • see remark 999 (162)
      • see remark 999 (168)
    Domains in SCOP 1.73: d2fcla1
  • Heterogens: UNL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fclA (A:)
    mgsdkihhhhhhmirpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqt
    deegayeierifsefvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedp
    vdlnkykrfvethgmkipvlsleyeyqaylklgrvekaetlrkwlnerk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fclA (A:)
    mirpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierif
    sefvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfvet
    hgmkipvlsleyeyqaylklgrvekaetlrkwlnerk