PDB entry 2fci

View 2fci on RCSB PDB site
Description: Structural basis for the requirement of two phosphotyrosines in signaling mediated by Syk tyrosine kinase
Class: hydrolase
Keywords: SH2 domain, phosphopeptide, Syk kinase, PLCgamma, PLCC, HYDROLASE
Deposited on 2005-12-12, released 2006-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-termainl SH2 domain from phospholipase C-gamma-1 comprising residues 663-759
    Species: Bos taurus [TaxId:9913]
    Gene: PLCG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08487 (5-101)
      • cloning artifact (0-4)
      • cloning artifact (102-104)
    Domains in SCOPe 2.05: d2fcia1
  • Chain 'B':
    Compound: Doubly phosphorylated peptide derived from Syk kinase comprising residues 338-350
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2FCI (Start-12)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fciA (A:)
gspgiheskewyhasltraqaehmlmrvprdgaflvrkrnepnsyaisfraegkikhcrv
qqegqtvmlgnsefdslvdlisyyekhplyrkmklrypineenss

  • Chain 'B':
    No sequence available.