PDB entry 2fc9

View 2fc9 on RCSB PDB site
Description: Solution structure of the RRM_1 domain of NCL protein
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM_1 domain, NCL protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-12-12, released 2006-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-06-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NCL protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ02 (7-94)
      • expression tag (0-6)
      • expression tag (95-100)
    Domains in SCOPe 2.08: d2fc9a1, d2fc9a2, d2fc9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fc9A (A:)
gssgssgnstwsgesktlvlsnlsysateetlqevfekatfikvpqnqngkskgyafief
asfedakealnscnkreiegrairlelqgprgspnsgpssg