PDB entry 2fc8

View 2fc8 on RCSB PDB site
Description: Solution structure of the RRM_1 domain of NCL protein
Class: RNA binding protein
Keywords: NMR, structure genomics, RRM_1 domain, NCL protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-12-12, released 2006-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-06-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NCL protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ02 (7-95)
      • expression tag (0-6)
      • expression tag (96-101)
    Domains in SCOPe 2.07: d2fc8a1, d2fc8a2, d2fc8a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fc8A (A:)
    gssgssgpnarsqpsktlfvkglsedtteetlkesfdgsvrarivtdretgsskgfgfvd
    fnseedakaakeamedgeidgnkvtldwakpkgeggsgpssg