PDB entry 2fbj

View 2fbj on RCSB PDB site
Description: refined crystal structure of the galactan-binding immunoglobulin fab j539 at 1.95-angstroms resolution
Deposited on 1989-08-18, released 1990-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fbjH (H:)
    evkllesggglvqpggslklscaasgfdfskywmswvrqapgkglewigeihpdsgtiny
    tpslkdkfiisrdnaknslylqmskvrsedtalyycarlhyygynaywgqgtlvtvsaes
    arnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalasggr
    ytmsnqltlpavecpegesvkcsvqhdsnpvqeldvncsg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fbjL (L:)
    eivltqspaitaaslgqkvtitcsasssvsslhwyqqksgtspkpwiyeisklasgvpar
    fsgsgsgtsysltintmeaedaaiyycqqwtyplitfgagtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec