PDB entry 2fbd

View 2fbd on RCSB PDB site
Description: The crystallographic structure of the digestive lysozyme 1 from Musca domestica at 1.90 Ang.
Class: hydrolase
Keywords: Digestive Lysozime, Musca domestica, HYDROLASE
Deposited on 2005-12-09, released 2006-12-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Gene: AY344589
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fbda_
  • Chain 'B':
    Compound: Lysozyme 1
    Species: MUSCA DOMESTICA [TaxId:7370]
    Gene: AY344589
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2fbdb_
  • Heterogens: SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fbdA (A:)
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2fbdB (B:)
ktftrcslaremyalgvpkselpqwtciaehessyrtnvvgptnsngsndygifqinnyy
wcqpsngrfsynechlscdalltdnisnsvtcarkiksqqgwtawstwkycsgslpsind
cf