PDB entry 2faz

View 2faz on RCSB PDB site
Description: Ubiquitin-Like Domain of Human Nuclear Zinc Finger Protein NP95
Class: Ligase
Keywords: Cell cycle; DNA damage; DNA repair; DNA-binding; Ligase; Metal-binding; Nuclear protein; Phosphorylation; Polymorphism; Transcription; Transcription regulation; Ubl conjugation; Ubl conjugation pathway; Zinc; Zinc-finger; STRUCTURAL GENOMICS CONSORTIUM, SGC
Deposited on 2005-12-08, released 2005-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like containing PHD and RING finger domains protein 1
    Species: HOMO SAPIENS
    Gene: UHRF1, ICBP90, NP95, RNF106
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96T88 (2-77)
      • cloning artifact (1)
    Domains in SCOP 1.75: d2faza1
  • Chain 'B':
    Compound: Ubiquitin-like containing PHD and RING finger domains protein 1
    Species: HOMO SAPIENS
    Gene: UHRF1, ICBP90, NP95, RNF106
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96T88 (2-End)
      • cloning artifact (0-1)
    Domains in SCOP 1.75: d2fazb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2fazA (A:)
gsmwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtl
fdyevrlndtiqllvrqs

    Sequence, based on observed residues (ATOM records): (download) 
    >2fazA (A:)
smwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtlf
dyevrlndtiqllvrqs

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2fazB (B:)
gsmwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtl
fdyevrlndtiqllvrqs

    Sequence, based on observed residues (ATOM records): (download) 
    >2fazB (B:)
gsmwiqvrtmdgrqthtvdslsrltkveelrrkiqelfhvepglqrlfyrgkqmedghtl
fdyevrlndtiqll