PDB entry 2fap

View 2fap on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-(c16)-ethoxy rapamycin complex interacting with huma
Class: complex (isomerase/kinase)
Keywords: fkbp12, frap, rapamycin, complex (isomerase/kinase)
Deposited on 1998-09-22, released 1999-05-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY (CLONTECH, PALO ALTO, CA)
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fapa_
  • Chain 'B':
    Compound: frap
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fapb_
  • Heterogens: RAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fapA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fapB (B:)
    vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdltqawdlyyhvfrris