PDB entry 2fal

View 2fal on RCSB PDB site
Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.151
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2fal__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fal_ (-)
    slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
    rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
    appagadaawtklfgliidalkaaga