PDB entry 2fa5

View 2fa5 on RCSB PDB site
Description: The crystal structure of an unliganded multiple antibiotic-resistance repressor (MarR) from Xanthomonas campestris
Class: transcription
Keywords: MarR, multiple antibiotics resistance repressor, transcriptional regulator, Xanthomonas campestris, Xcc structural genomics, X-ray diffraction
Deposited on 2005-12-06, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator marR/emrR family
    Species: Xanthomonas campestris [TaxId:339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA5
      • modified residue (46)
      • modified residue (74)
      • modified residue (105)
      • modified residue (126)
      • modified residue (131)
      • modified residue (157)
    Domains in SCOPe 2.07: d2fa5a_
  • Chain 'B':
    Compound: transcriptional regulator marR/emrR family
    Species: Xanthomonas campestris [TaxId:339]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PDA5
      • modified residue (46)
      • modified residue (74)
      • modified residue (105)
      • modified residue (126)
      • modified residue (131)
      • modified residue (157)
    Domains in SCOPe 2.07: d2fa5b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fa5A (A:)
    msdldtptpsphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilal
    ypgssasevsdrtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetv
    aplvnemeqrlmsvfsaeeqqtlerlidrlakdglprmaskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fa5A (A:)
    hpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasevsd
    rtamdkvavsravarllergfirrsmlalspagrqvyetvaplvnemeqrlmsvfsaeeq
    qtlerlidrlakdglprma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fa5B (B:)
    msdldtptpsphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilal
    ypgssasevsdrtamdkvavsravarllergfirrethgddrrrsmlalspagrqvyetv
    aplvnemeqrlmsvfsaeeqqtlerlidrlakdglprmaskd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fa5B (B:)
    sphpvllnleqflpyrlsvlsnrisgniakvygdrygmaipewrvitilalypgssasev
    sdrtamdkvavsravarllergfirresmlalspagrqvyetvaplvnemeqrlmsvfsa
    eeqqtlerlidrlakdglprma