PDB entry 2f51

View 2f51 on RCSB PDB site
Description: Structure of Trichomonas vaginalis thioredoxin
Class: electron transport
Keywords: thioredoxin fold, ELECTRON TRANSPORT
Deposited on 2005-11-25, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.147
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: trx
    Database cross-references and differences (RAF-indexed):
    • GB CAD47836 (Start-111)
    Domains in SCOPe 2.07: d2f51a1, d2f51a2
  • Chain 'B':
    Compound: thioredoxin
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: trx
    Database cross-references and differences (RAF-indexed):
    • GB CAD47836 (Start-111)
    Domains in SCOPe 2.07: d2f51b1, d2f51b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f51A (A:)
    msdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikv
    dvdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f51A (A:)
    sdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikvd
    vdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f51B (B:)
    msdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikv
    dvdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f51B (B:)
    sdpivhfngtheallnrikeapglvlvdffatwcgpcqrlgqilpsiaeankdvtfikvd
    vdkngnaadaygvssipalffvkkegneiktldqfvgadvsrikadiekfk