PDB entry 2f2v

View 2f2v on RCSB PDB site
Description: alpha-spectrin SH3 domain A56G mutant
Class: signaling protein
Keywords: Src homology 3 domain spectrin, SIGNALING PROTEIN
Deposited on 2005-11-18, released 2006-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-05-20, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spectrin alpha chain, brain
    Species: Gallus gallus [TaxId:9031]
    Gene: SPTAN1, SPTA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (1-61)
      • initiating methionine (0)
      • engineered (55)
    Domains in SCOPe 2.06: d2f2va_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2vA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpagyvkk
    ld