PDB entry 2f2h

View 2f2h on RCSB PDB site
Description: Structure of the YicI thiosugar Michaelis complex
Class: hydrolase
Keywords: beta8alpha8 barrel, HYDROLASE
Deposited on 2005-11-16, released 2006-02-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2ha1, d2f2ha2, d2f2ha3, d2f2ha4
  • Chain 'B':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2hb1, d2f2hb2, d2f2hb3, d2f2hb4
  • Chain 'C':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2hc1, d2f2hc2, d2f2hc3, d2f2hc4
  • Chain 'D':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2hd1, d2f2hd2, d2f2hd3, d2f2hd4
  • Chain 'E':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2he1, d2f2he2, d2f2he3, d2f2he4
  • Chain 'F':
    Compound: Putative family 31 glucosidase yicI
    Species: Escherichia coli [TaxId:562]
    Gene: yicI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31434 (0-771)
      • expression tag (772)
    Domains in SCOPe 2.04: d2f2hf1, d2f2hf2, d2f2hf3, d2f2hf4
  • Heterogens: SO4, MPO, XTG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hA (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hB (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hC (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hD (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hE (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f2hF (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh