PDB entry 2f2e

View 2f2e on RCSB PDB site
Description: Crystal Structure of PA1607, a Putative Transcription Factor
Class: DNA binding protein/structural genomics
Keywords: Transcription factor, helix-trun-helix, APC5613, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, DNA BINDING PROTEIN/STRUCTURAL GENOMICS COMPLEX
Deposited on 2005-11-16, released 2006-03-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pa1607
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1607
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3B4 (Start-145)
      • modified residue (26)
      • modified residue (66)
    Domains in SCOPe 2.01: d2f2ea1
  • Chain 'B':
    Compound: pa1607
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA1607
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I3B4
      • modified residue (26)
      • modified residue (66)
    Domains in SCOPe 2.01: d2f2eb_
  • Heterogens: GLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f2eA (A:)
    mvkrtshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrn
    lvehgvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsg
    qpvprlqvragdgsplaaedtrvsrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2eA (A:)
    tshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlveh
    gvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvp
    rlqvragdgsplaaedtrvsrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f2eB (B:)
    mvkrtshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrn
    lvehgvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsg
    qpvprlqvragdgsplaaedtrvsrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f2eB (B:)
    shkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlvehg
    vmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvpr
    lqvragdgsplaaedtrvsr